PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33349.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 339aa    MW: 37874.3 Da    PI: 6.8605
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33349.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++   +G g+W+ +ar  g+ R++k+c++rw +yl
       KHN33349.1 23 KGLWSPEEDDKLMNYMLNHGQGCWSDVARNAGLQRCGKSCRLRWINYL 70
                     678*******************************************97 PP

2Myb_DNA-binding50.64.6e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++ + +lG++ W+ Ia++++ gRt++++k++w++
       KHN33349.1  76 RGAFSPQEEELIIHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 119
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-241773IPR009057Homeodomain-like
PROSITE profilePS5129416.8661870IPR017930Myb domain
SuperFamilySSF466894.12E-2821117IPR009057Homeodomain-like
SMARTSM007171.1E-102272IPR001005SANT/Myb domain
PfamPF002493.5E-142370IPR001005SANT/Myb domain
CDDcd001672.33E-92670No hitNo description
PROSITE profilePS5129424.71571125IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2574124IPR009057Homeodomain-like
SMARTSM007171.8E-1575123IPR001005SANT/Myb domain
PfamPF002497.1E-1576119IPR001005SANT/Myb domain
CDDcd001673.83E-1178118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MRKPEASNNN TKNNNNNSKK LRKGLWSPEE DDKLMNYMLN HGQGCWSDVA RNAGLQRCGK  60
SCRLRWINYL RPDLKRGAFS PQEEELIIHF HSLLGNRWSQ IAARLPGRTD NEIKNFWNST  120
IKKRTIKKRL RNMSSTTTTT SPSPSSNASE TSISEPSNKD LNMGGFISTQ HNQHAGFVPM  180
FGSSPSPSIM QTGTVFNTLI DRLPMLEHGL NMPASGGYFE GTGIPCFSQS EVNKLGSCYL  240
ENGVFGRSVN IGVEGDMFVP PLENATCSRR ETTNSSYFDD DINSILNNCN IGIGENKAHD  300
GVENLFQQEL ATATATGEWD FEELMKLDVS SFPFLDFSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27211245107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1400962e-96BT140096.1 Lotus japonicus clone JCVI-FLLj-12H15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235775.10.0MYB transcription factor MYB82
TrEMBLA0A0B2RM200.0A0A0B2RM20_GLYSO; Transcription factor MYB46
STRINGGLYMA15G03920.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-69myb domain protein 46
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]